ELF4x4 (4444448800700HHH Ptdܭ--Qtd/lib/ld-linux.so.2GNUae@?I.M0KA=:[+JN<S5Pa\ ;Z^HY]b 8 Gc9WE_TUQ*&71`Vd!CL $"# ,'42/>6)BO(-FR%DX3$ YX 70)00?(7)&D*e:n,7dTM/07* (T47878<7^0'm9B%'j^[u@704<]<D77H7:v(;W X Hq)p?s*8L7e.kpO'e*7Dg:h7w/j$P7IX7p7u4t78!*@ ??!^pc libproc-3.2.6.soopen_psdb_messagedev_to_ttysmp_num_cpuskb_main_freeprocps_versionHertzget_pid_digitsmeminfokb_swap_freekb_main_usedsprint_uptimesignal_name_to_numberopenprockb_main_buffersescape_commandlinux_version_codecloseprocreadtaskkb_main_totalkb_swap_usedkb_swap_totallookup_wchanreadproc_Jv_RegisterClasseskb_main_cached__gmon_start__libncurses.so.5tparm_DYNAMICtgoto_initcur_termputp_finisetuptermlibc.so.6strcpyioctl__strtod_internalstdoutstrerrormemmovegetenvsetpriority__strtol_internalbsearchgetpidgetpagesizeqsortfgetsmemcpytcflushgetuidsleepvsnprintfselect__strtoul_internalfflushsetbufferstrrchr__ctype_tolower_loccallocfprintfkillstrstrsignalreadstrncmpreallocsscanfgettimeofdaymemsettcgetattrstrcmpgetpwnamsprintffclosestrcspnstderr__ctype_b_locrewind__errno_locationexitfopen__ctype_toupper_loc_IO_stdin_usedstrspn__libc_start_mainstrlenstrchrfputsfcntltcsetattrstrpbrkraise_edata__bss_start_endGLIBC_2.1GLIBC_2.3GLIBC_2.0_3_2_5@ii ii ii  %()0c 7(7 ,70747 87"<7#@7,D71H75L7EP7VX7Wp7Xt7[0111 111 1 1 1 $1(1,1014181<1@1D1H1L1P1T1X1\1`1!d1$h1%l1&p1't1(x1)|1*1+1-1.1/101214161718191:1;1=1>1?1@1A1B1C1D1F1G1H1I1J1K1L1M1O1Q1R2S2T2U 2Y2\2]2_2` 2a$2b(2c,2dUhq50%0%0h%1h%1h%1h% 1h %1h(%1h0%1h8p%1h@`% 1hHP%$1hP@%(1hX0%,1h` %01hh%41hp%81hx%<1h%@1h%D1h%H1h%L1h%P1h%T1h%X1hp%\1h`%`1hP%d1h@%h1h0%l1h %p1h%t1h%x1h%|1h%1h%1h%1h%1h %1h(%1h0%1h8p%1h@`%1hHP%1hP@%1hX0%1h` %1hh%1hp%1hx%1h%1h%1h%1h%1h%1h%1h%1hp%1h`%1hP%1h@%1h0%1h %1h%1h%1h%1h%2h%2h%2h% 2h %2h(%2h0%2h8p%2h@`% 2hHP%$2hP@%(2hX0%,2h` 1^PTRhhQVhUSQ[˜tX[ÐUPP=x7t H2ҡH2ux7ÉUQQ0tt h0ЃÐT$D$  )ȋCÍt&T$D$ AJ)ȋCÉT$D$  QPCƒÉT$D$ )ȋ CÍT$D$  QPOCƒÉL$D$ppRP CÉT$D$ )ȋCÍT$D$ )ȋCÍT$D$ )ȋCÍT$D$ )ȋCÍL$D$A9BrvCËC1É'V CSɋD$ T$tLY(q,Y P(q$YqYqP H,H$PHPH9v4C6[^ÉYqYPqPHH9wsCʃ[^9r9s1[^w9w1&L$D$9|~CËC1Ít&L$D$)ы+9|~CËC1Ít&L$D$9|~CËC1Ít&L$D$9|~CËC1Ít&L$D$9|~CËC1Ít&L$D$9|~CËC1Ít&L$D$9rvCËC1Ít&L$D$9|~CËC1Ít&T$L$@ J C)à CD$T$t@totSPCPP QCƒ ˬQQPRCƒ ÍvC Ðt&tC Ít&'L$D$9rvCËC1Ít&L$D$9rvCËC1Ít&D$T$@J) WVSà 87׉Pu#PVWjVVjj؃[^_Phgjj@ VWj h`gjj!VVjjS؃[^_Ív'T$$T$RD$$Ph@h88,Í&SÃh$PtZY[ =7 u PRQ H7QB(P Í'Wǡ7VS։tca1 P$`$`$ tY87Rt PPWS V[Phgjj뉍& 1ɺ87\Sà 87Q>@g$Rh,h@h@@7 u"P<7h@@h1P$@@<7&'hgjja1r$j$`^$`R$ FX87Ry$7aauQh`gjj h aD$ a&'UWVS Nj570A{H7B@tQQPh`aH7JAtRRPh@aH7jEtUUPh anH7r~jEPtQQPh`AH7rF@tRRPh`!H7ZC0tUUPh`H7BtVVPh``H7JtSSPh@`H7j tƒ Rh``h j h `$H7jjsV(Rt 7A``u H7APl tЍRRPUlH7r f~XPPPZR*Y[PVXH7ZDQXR$@`Ph j@V9H7QXR,$Ph j@VH7QXR$@`Ph j@VH7DQXRW$h `h j@V u@` UVh j@SiV$ [^_]ÐDƇPPh@`R^XUVwY[h@`DQ^XZh``VQZZ`tVVPha/H7B\tSSPh` H7=at =`a`JyzakvSX$d$TR$dPh@\$ SSRT$, ǁ\$ 1$SSjD$ PSD$8BB9<$|$ vt$ T$ t$$rtmU9NjL$ 1)׉t$C9t"9uCǂ9uރ \$0VzT$4 ǁPt$(RL$0Q|$ Wt't$\$ E$B\$ 92 |$4W9-BC|$$\$ \$0VT$4 ǁ]t&W3VSփCt!99t  9u3[^_1[^_ÉWVD=7tVjjhD^_QjjjXZhgj@|$g7L$T$ L$T$ D$D$PD$ PjjK@tRPPh`gj 87hhXQ$ arX87PD^_øC h aF_RZYPhUWVS׋ a-aʉD$CT$PT$D$t| CDRt$KD$L$@D$T$)RRWQPhhV-{VaPPj WÅu h `>Ĭ[^_]ÉD$``D$ T$L$ VSt$VT$(R\$0SPhhL$HQ$t$(V\$C\$\$ D$Ê1"k\$fX%t^; t-vFCD$*„T$9t&C; uC; tʼnVSVRjhR$^,jShP$[^Ðt& D$tGD$<1|!<4! PtLC ";aL$D$$L$@|$G0t 9D$$|$ u$l$ M S€ZTCptD$Ƅ$=`2|$,$D$uFuuCL$ 9uUvL$ C9;;u`=`ŋ `@`9ۉ|$T `=`Ë `@`9ލ|$T| TD$fl$ SD$4Pj T$`RD$dT$U B<0uB.=6%T$\$ Ph4h$SV|$,6|$$T 　҃ R$d UhD$8PL$pQ T$t T$QQl$\UPP|$DWh$pU L$t _l$ щPT$4Rh$`Qd@L$t l$ b멋L$t /L$ bxL$t l$ ͋T$t T$ B P\$4S4L$t x|$ L$t vl$ bL$t |$ b)L$t L$ T$t D b11D$,RW P7,$ -UQ,$\$D$Sh$pP bT$ ЋzjzjT$T$D@t*‹@(D$R,T$ T$ B R$D$T$ |$l$ D$DtD$;tى:PD$4Ph$`RL$ 1ҋYRS,$ CbEf؋T$t $T$t \$ RD$4PT$t }T$ W\$4SL$ =zL$4T$t 2T$ pRl$4Uh$`WL$t |$ UT$t }D$  P둋T$t M|$ _Sl$4UT$tT$ :W\$4ST$t D$  P\$TSl$ Rh4ND$t =h |$XWWS\$\SUBWUl$\US T$PPL$(PUNPT$DRh$S& |$t|$  Rt D$DWWPS|$(Wh(h$pPL$8T$LT$L \$t\$ { RL$T$,T$,qRRL$(SPPl$DUh$pR` t. V5aVhh$hUmU[^_]FWF h`a$\ PhQh$hS 7Xҍ$Lt U@t$FF`=`ŋ `@`9ۉ$Lu PS$TSU<랍&WVSÃ0ы8p<$@8)${t$S<|$C@T$s)D${t$ SDCH|$T$ s )D$SLt$T$C+CPSSTqRP,$D$T${ CX|$ s$)D$ {(t$$|$(S\C`T$$s,)D$(t$,Sds0T$,{4+sh${lD$T$T$ D$T$D$T$D$ T$$D$(T$,RP,$WV,$Ƀ0 -\$0l$`\$(l$X\$ \$l$H\$l$@\$l$8$Q 6Q@1Ka;sSK@{8s<{ sS@KDSK aC{LCH{$sPSTs,KXC(S0K4{\sdC`ShKl0[^_ÍD$D$| t&UPWVSLpws$&< `0 &     Cu#CuCL[^_]ø CL[^_]á`2tɋ-C벋-`2t5C둡Cx=`2Cs4P;Ht; uj9+rCǂ(7C=`2%`2 C=`2Cs4;C4t;ui<9\qN1B-d2 d2uPPRh+5`2+C l$ f  fGh a $`iD$HA t  Ch`%PRh`h06 ¸gT$H11T$Hq5CSaWWRUt KA5C h`& h a$`-7c  Ch2@uQS$RPhX7hN \$H{1D$HC@RRhhcDž @gPRh`W?-C C d2`2ikBVDCh2$QPhWD$0 l$L$1B=wt&#1ҊA.tBvT4 Fuލt$ VUhW W蝿X QPRhWvVQP RhWFt$0L$(F t$0L$( |$8 WhSShch~ =H7 Cw \$f~ a h a$`D$+T h`~C\$+uuu PUSWVQPhX7h40¸T$H1D$HPЃJ$' `2!l-`2^C CK-`2C `2C@@uVVRh) 5`2Co5uPPRhob1ɺ6;B- A uD< Jtt t t t  CC57W% C 5C-`2CWWRh xg=CV`2tC h a荽$`聽=C H5C h %QVh`h  ¸T$H1.1T$HuT$H8T$ ,=CQQUS肺ƅ蠾T$ f,Qz69. L$HB\$HZ=C jO=`2Cj-C=`2CY-`2C `2CS`2C$ 7 h2$hÊR  S =T _ʀ,919@tʀ,t9t9ul5`2CehS.5`2tC h ad$`X=C?踺|$H4=CQQVSɷn…cEa=C -C h%QUh`h s ¸T$H11T$H(Sh-`2C 񀉈`2=CSSWhdZYP\$,SN|$ ڡC CCT$D$TCL$H qÄ.q1ҡCYqL$Չ뺋C룡C덋=Cs5CD$H|$S CD$MT$3CD$Sl$CD$TD$E RRPShƅ>N RRQSJ]A=C "Cy C C`CCaC{CCo ÅPPSh y PSj[f 8W;PVSh<> V1CC3CC<C ];pKR^i S>VPhchh 2M%IC 6 1,t@t,ujV|$LWhSlD$X-Eu}h2ʀ,t19t@ʀ,9uCCUj WWhQ S3Dt&UWVSCCD$ T$`2tL$1\$ǃJL$t$L$ Ɔ`2͉΅tt&֊VAuL$D$(.\$(|$ T$R-Z d6Q)Ƌ|$a\$ )7D$ 1XT$5`2t41Ɉ3tctw}tbC BMuCG3 ʉCT$;1Ʌt3uD$ 똍t&C݀;uC똋T$h6hPPQf€}tC BMuD$OCCG3 ʉCT$;C`2Ml$],0`20Ct$>|$9T$T$  CUCt@CЅu C@p-` `WUjP uVGt֊GVuT$(L$$B|$T$(D$(L$$;|I`袭 C VQRS=66PPh0j赩J6 VCD$J0$P D75L7p7-P7VQRUhd! 1" =47@7t75(7WPSVh!躴 1 aC aC C VQRSЃ CVVh h E4B45b<)t藿11ۋ8BFlpUh h@|$DW8BT$H؃ti;5b|  C CY)Ѝ "C1 h a87Sh@Bh1P'$5@gh )VRhT#蔟ߠ@B1ҡ87 4)<)C;uÃMWQhS贖HYQQSh  X78? YC򀉐C;u?ÃPhp3h"S<Hu p3PPSh 苞֟=CLJ =Cƒp{CCp;uÃ7~ 7WQh"S蚕HuR=7<7|Bu7=7GQ7Qj,SΑÄWVVSh2 襝PPjh 蒝ݞ Ӟ ɞ 连UWV(EEU׉EU EEEUu!91E܉M؋E؋U܃(^_];}ǃEU )ЊMEEM ŠMuEUԊMU}M UMEuԉUЉ9Ur 9tD1IE܉M؋E؋U܃(^_]ËutqEƋEE܉M؋E؋U܃(^_]11M؉E܋E؋U܃(^_]Ðt&M;}9Mt1E܉M؋E؋U܃(^_]Ív1u끐UWVS [b-n)Eu [^_]1֍t&G;}r [^_]Í'UWVS[- )EHt41G9}u4 [^_]ÐUSR0t0ЋCuX[]ÐUSP[Î,X[ %5uProcess IdParent Process Pid RUSER %-8.8sReal user name UID %4uUser Id USER User Name GROUP Group Name TTY Controlling Tty PR %3dPriority NINice value #C %2uLast used cpu (SMP) %CPU %#4.1fCPU usage TIME %6.6sCPU Time TIME+ %9.9sCPU Time, hundredths %MEMMemory usage (RES) VIRT %5.5sVirtual Image (kb) SWAP %4.4sSwapped size (kb) RESResident size (kb) CODECode size (kb) DATAData+Stack size (kb) SHRShared Mem size (kb) nFLTPage Fault count nDRTDirty Pages count S %cProcess Status COMMAND %-*.*sCommand name/line WCHAN %-9.9sSleeping in Function Flags %08lxTask Flags %s: %s *** %s ***%s%s %s %s%s%s%s%s: %s%s%u%.1f%c%d%c?%lu:%02u.%02u%lu:%02u%lu,%02u%uh%ud%uwfailed memory allocatedumbfailed tty getfailed tty set: %s%s%s%c %c: %-10s = %s%s%.*s%d:%.*sCOLUMNSLINES-1234567890Not valid%d %s%s%s%s RT %08lx %s%.*s%s%s%s%.*s%s%s%s MemoryNumericalNothing to highlight!Change delay from %.1f to%fabcdefghijklmnopqrstuvwxyzOnOffShow threads %sIrix mode %sPID to killKill PID %d with signal [%i]PID to reniceRenice PID %d to valueCumulative time %sWhich user (blank for all)%s fieldscur=%s Failed '%s' open: %sWrote configuration to '%s'No colors to map! %s -%s %s -%s r/proc/statFailed /proc/stat open: %sfailed /proc/stat readCpu(s):Cpu%-3d: %4.0f %1u %3u P %%%uu PID PPID/etc/toprcTOPRCHOME%s/.%src RCfile for %3s fieldscur=%31s -d requires argumentbad delay '%s'%s usage: %s%s-n requires argumentbad iterations arg '%s'conflicting process selection-p argument missingpid limit (%d) exceededbad pid '%s'-u missing name- ,.1234567890Delay time Not changed%s %#5.1f%% user, %#5.1f%% system, %#5.1f%% nice, %#5.1f%% idle Command disabled, activate %s with '-' or '_'Flags field: 0x00000001 PF_ALIGNWARN 0x00000002 PF_STARTING 0x00000004 PF_EXITING 0x00000040 PF_FORKNOEXEC 0x00000100 PF_SUPERPRIV 0x00000200 PF_DUMPCORE 0x00000400 PF_SIGNALED 0x00000800 PF_MEMALLOC 0x00002000 PF_FREE_PAGES (2.5) 0x00008000 debug flag (2.5) 0x00024000 special threads (2.5) 0x001D0000 special states (2.5) 0x00100000 PF_USEDFPU (thru 2.4) %sCurrent Fields:  %s  for window %s %s Note1: If a selected sort field can't be shown due to screen width or your field order, the '<' and '>' keys will be unavailable until a field within viewable range is chosen. Note2: Field sorting uses internal values, not those in column display. Thus, the TTY & WCHAN fields will violate strict ASCII collating sequence. (shame on you if WCHAN is chosen) %sCurrent Sort Field:  %c  for window %s %s Rename window '%s' to (1-3 chars) k,r Manipulate tasks: 'k' kill; 'r' renice d or s Set update interval Help for Interactive Commands - %s Window %s: Cumulative mode %s. System: Delay %.1f secs; Secure mode %s. Z,B Global: 'Z' change color mappings; 'B' disable/enable bold l,t,m Toggle Summaries: 'l' load avg; 't' task/cpu stats; 'm' mem info 1,I Toggle SMP view: '1' single/separate states; 'I' Irix/Solaris mode f,o . Fields/Columns: 'f' add or remove; 'o' change display order F or O . Select sort field <,> . Move sort field: '<' next col left; '>' next col right R,H . Toggle: 'R' normal/reverse sort; 'H' show threads c,i,S . Toggle: 'c' cmd name/line; 'i' idle tasks; 'S' cumulative time x,y . Toggle highlights: 'x' sort field; 'y' running tasks z,b . Toggle: 'z' color/mono; 'b' bold/reverse (only if 'x' or 'y') u . Show specific user only n or # . Set maximum tasks displayed %s W Write configuration file q Quit ( commands shown with '.' require a visible task display window ) Press 'h' or '?' for help with Windows, any other key to continue Help for Windows / Field Groups - "Current Window" =  %s  . Use multiple windows, each with separate config opts (color,fields,sort,etc) . The 'current' window controls the Summary Area and responds to your Commands . that window's task display can be turned Off & On, growing/shrinking others . with NO task display, some commands will be disabled ('i','R','n','c', etc) until a different window has been activated, making it the 'current' window . You change the 'current' window by:  1) cycling forward/backward; 2) choosing a specific field group; or 3) exiting the color mapping screen . Commands available anytime ------------- A . Alternate display mode toggle, show Single / Multiple windows G . Choose another field group and make it 'current', or change now by selecting a number from:  1 =%s; 2 =%s; 3 =%s; or 4 =%s . Commands requiring 'A' mode ------------- g . Change the Name of the 'current' window/field group * a , w . Cycle through all four windows: 'a' Forward; 'w' Backward * - , _ . Show/Hide: '-' Current window; '_' all Visible/Invisible The screen will be divided evenly between task displays. But you can make some larger or smaller, using 'n' and 'i' commands. Then later you could: * = , + . Rebalance tasks: '=' Current window; '+' Every window (this also forces the current or every window to become visible) In 'A' mode, '*' keys are your essential commands. Please try the 'a' and 'w' commands plus the 'G' sub-commands NOW. Press to make 'Current' Kill of PID '%d' with '%d' failed: %sMaximum tasks = %d, change to (0 is unlimited)Renice of PID %d to %d failed: %sRCfile for "%s with windows" # shameless braggin' Id:a, Mode_altscr=%d, Mode_irixps=%d, Delay_time=%.3f, Curwin=%u winflags=%d, sortindx=%d, maxtasks=%d summclr=%d, msgsclr=%d, headclr=%d, taskclr=%d Help for color mapping - %s current window: %s color - 04:25:44 up 8 days, 50 min, 7 users, load average: Tasks: 64 total, 2 running, 62 sleeping, 0 stopped, Cpu(s): 76.5%% user, 11.2%% system, 0.0%% nice, 12.3%% idle  Nasty Message!  -or- Input Prompt  PID TTY PR NI %%CPU TIME+ VIRT SWAP STA Command  17284 pts/2  8 0 0.0 0:00.75 1380 0 S /bin/bash   8601 pts/1 7 -10 0.4 0:00.03 916 0 R < color -b  11005 ?  9 0 0.0 0:02.50 2852 1008 S amor -ses  available toggles: B =disable bold globally (%s), z =color/mono (%s), b =tasks "bold"/reverse (%s) Select target as upper case letter: S = Summary Data, M = Messages/Prompts, H = Column Heads, T = Task Information Select color as number: 0 = black, 1 = red,  2 = green, 3 = yellow, 4 = blue,  5 = magenta, 6 = cyan,  7 = white Selected: target  %c ; color  %d  press 'q' to abort changes to window '%s' press 'a' or 'w' to commit & change another, to commit and end Unknown command - try 'h' for helpTasks: %3u total, %3u running, %3u sleeping, %3u stopped, %3u zombie cpu %Lu %Lu %Lu %Lu %Lu %Lu %Lucpu%u %Lu %Lu %Lu %Lu %Lu %Lu %LuMem:  %8uk total, %8uk used, %8uk free, %8uk buffers Swap: %8uk total, %8uk used, %8uk free, %8uk cached %s %#5.1f%% user, %#5.1f%% system, %#5.1f%% nice, %#5.1f%% idle, %#5.1f%% IO-wait %s %#4.1f%% us, %#4.1f%% sy, %#4.1f%% ni, %#4.1f%% id, %#4.1f%% wa, %#4.1f%% hi, %#4.1f%% si Id:a, Mode_altscr=%d, Mode_irixps=%d, Delay_time=%f, Curwin=%d winflags=%d, sortindx=%u, maxtasks=%d summclr=%d, msgsclr=%d, headclr=%d, taskclr=%d unknown argument '%c' usage: %s%sAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZzJj......AaBb..CcDd..GgHhIiYyEeWw..FfMmOoTtKkLlPpJjSsVvXxUuZz[{QqNnRr User name does not exist.User ID out of range.````````````` `````Choose field group (1 - 4)X,W(y@b4SUpper case letter moves field left, lower case rightSelect sort field via field letter, type any other key to returnToggle fields via field letter, type any other key to returnUnavailable in secure modeppSm".m%Y,p5QBiWGqQQs,,,,,,,,6}cM -hv | -bcisSH -d delay -n iterations [-u user | -U user] -p pid [,pid ...]@@ 9DefAEHIOQTWKNMbcdfgjplrsuvyzX9JobABcefgjlrstuvyzMKNHIWOPQDX 9MemANOPQRSTUVbcdefgjlmyzWHIKX9UsrABDECGfhijlopqrstuvyzMKNWX##4E^oKNh'NNư>_B$tI;4,zR| (n r  Xh؊  0h ooo06FVfvƓ֓&6FVfvƔ֔&6FVfvƕ֕&6FVfvƖ֖&6FVfvƗ֗ 0@@ 9DefAEHIOQTWKNMbcdfgjplrsuvyzX9JobABcefgjlrstuvyzMKNHIWOPQDX 9MemANOPQRSTUVbcdefgjlmyzWHIKX9UsrABDECGfhijlopqrstuvyzMKNWXAaAa4 BbBb@ ИCcQq(DdCc EeDdPFfNn0GgGg@HhHh"',@IiIi5':@JjYyEI@N@KkEebhpp@LlWwz@MmRr @NnFfhOoMm`PpOoQqTtRrKk+01SsLl@pFTtPp[aUuJjv|@VvSs0WwVvpXxXxYyUu@@ZzZz@x kmgDINWM ^NdP T GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment 44HH !hh ' P/؊ 7oDo`S   \ h e`  kXlqXXw\) -ܭ-H000000@@2@  70